TB-500 vs GHK-Cu: How Do They Differ?

Sequence, structure, and molecular origin

TB-500 is a 43-amino-acid peptide fragment derived from thymosin beta-4, a natural protein found in mammals. The sequence is the complete thymosin beta-4 sequence: MSKGDPPVSSYYIDSLLVGREWSPDHEHDISDDDPFAAFQQSKKSK-COOH. This full-length sequence is sufficiently long to form secondary structures including alpha-helical regions, localized turns, and loops. The 43-residue peptide engages multiple protein-binding partners and exhibits intrinsic disorder in its free state, undergoing conformational changes upon binding to molecular targets.Review · PMID 27450730Review · PMID 17947587

GHK-Cu is a 3-amino-acid tripeptide (Gly-His-Lys) complexed with copper in a 1:1 stoichiometry. The histidine residue coordinates the copper atom, making copper an integral structural component essential to the complex. GHK-Cu is much shorter and contains a metal cofactor essential to its molecular structure and signaling. The tripeptide is synthesized de novo or derived from collagen hydrolysates; it is not a product of a specific natural protein but a minimal peptide selected for copper-binding properties.In vitro · PMID 32371360In vitro · PMID 33263328

The compositional difference between TB-500 and GHK-Cu is fundamental and shapes their molecular properties and research applications. TB-500's 43-residue sequence provides a scaffold for multiple molecular interactions and actin binding, enabling broad molecular interactions with cellular targets. GHK-Cu's minimal 3-residue structure with metal coordination specializes the complex for specific extracellular-matrix signaling interactions dependent on copper coordination. These distinct molecular architectures result in different experimental approaches and biological contexts studied in cultured-cell research systems.Review · PMID 27450730In vitro · PMID 32371360

Actin-binding and dynamics versus extracellular-matrix signaling

TB-500 research is primarily focused on actin-monomer sequestration and actin-dynamics signaling in cultured cell systems. The 43-residue peptide binds G-actin (monomeric actin) with defined stoichiometry, preventing actin polymerization and modulating the cytoskeletal dynamics of cultured cells. TB-500 is characterized as an actin-sequestering protein that participates in cellular mobility, cytoskeletal remodeling, and actin-dependent signaling. Experiments measure actin polymerization state by biochemical assays, cytoskeletal organization by immunofluorescence, and actin-binding kinetics by biophysical methods.In vitro · PMID 1999398In vitro · PMID 10848969

GHK-Cu research is heavily concentrated on extracellular-matrix biology and remodeling responses in cultured fibroblasts. The copper tripeptide is characterized as modulating collagen synthesis, matrix-metalloproteinase expression, and extracellular-matrix-remodeling signaling. Experiments measure collagen-I and collagen-III production by ELISA and Western blotting, matrix-metalloproteinase activity by zymography, and fibroblast-proliferation assays. The copper-peptide complex modulates extracellular-matrix-focused cellular responses.In vitro · PMID 32371360In vitro · PMID 28805225

This mechanistic divergence reflects distinct molecular targets and research contexts. TB-500 targets actin monomers and cytoskeletal dynamics—intracellular molecular systems governing cell mobility and morphology. GHK-Cu targets extracellular-matrix signaling pathways—primarily concerned with matrix-protein synthesis and remodeling signaling. One peptide modulates cytoskeletal dynamics through actin binding; the other modulates extracellular-matrix remodeling through copper-coordinated signaling interactions.In vitro · PMID 1999398In vitro · PMID 32371360

Structural characterization and biophysical studies

TB-500's structural properties have been characterized through nuclear magnetic resonance spectroscopy and biophysical techniques. The 43-residue peptide exhibits conformational disorder in its free state, with NMR spectroscopy revealing localized alpha-helical structural elements within an otherwise disordered sequence. Upon binding to actin monomers, the peptide undergoes a disorder-to-order transition, establishing defined interactions with the actin target. The structural flexibility of TB-500 permits binding to multiple actin molecules and engagement with diverse actin-binding partners.Review · PMID 27450730In vitro · PMID 10848969

GHK-Cu's structural properties are characterized through computational and theoretical studies including density functional theory and molecular dynamics simulation. The copper-peptide complex exhibits defined coordination geometry with stable equatorial and apical bonding environments. Electrochemical studies establish reduction potentials and electron-transfer reversibility at the copper center. The metal-peptide structure remains stable across physiological conditions modeled in in-vitro systems, in contrast to TB-500's conformational flexibility.In vitro · PMID 32371360In vitro · PMID 33263328

The contrast in structural characterization methods reflects the peptides' distinct properties: TB-500 exhibits disorder-to-order transition behavior requiring dynamic NMR and biophysical characterization, while GHK-Cu exhibits stable metal coordination requiring computational and electrochemical analysis. TB-500's intrinsic disorder enables multiple molecular interactions, while GHK-Cu's copper coordination constrains the complex to defined signaling interactions.Review · PMID 27450730In vitro · PMID 32371360

Cultured cell systems and experimental models

TB-500 is characterized in cultured cell types relevant to actin-dependent processes: fibroblasts measuring cell migration and cytoskeletal organization, endothelial cells measuring vascular tube formation and cell mobility, contractile-cell types measuring contractility signaling and actin dynamics, and neural cells measuring neurite outgrowth and axonal dynamics. TB-500 readouts include actin-polymerization assays, cytoskeletal reorganization by immunofluorescence, cell-migration assays, and actin-binding kinetics measured by surface-plasmon resonance or other biophysical techniques.Review · PMID 27450730Review · PMID 17947587

GHK-Cu is characterized primarily in cultured fibroblasts and connective-tissue cells. The copper tripeptide is added to cultured cells, and extracellular-matrix-related molecular readouts are measured: collagen synthesis by ELISA and quantitative reverse-transcription polymerase chain reaction, matrix-metalloproteinase expression by Western blotting and zymography, and fibroblast-proliferation assays. Signaling readouts include phosphorylation of kinases implicated in fibroblast activation.In vitro · PMID 32371360In vitro · PMID 28805225

The cultured cell systems reflect each peptide's primary molecular target and research emphasis. TB-500 is studied in actin-dependent cell types measuring actin dynamics and cell mobility. GHK-Cu is studied in extracellular-matrix-producing cells measuring matrix-remodeling signaling. These distinct experimental models highlight the peptides' specialized roles in different molecular and cellular contexts.Review · PMID 27450730In vitro · PMID 32371360

Absence of comparative studies and research gaps

There is no literature directly comparing TB-500 and GHK-Cu in the same cultured cell systems or assessing their relative potencies for any shared cellular response. The two peptides have not been tested in parallel cultured-cell assays or co-incubated in the same experimental models. The distinct research literatures are conducted independently without cross-comparison studies. The molecular targets and signaling intermediates through which the peptides function have not been directly compared.Review · PMID 27450730In vitro · PMID 32371360

Neither literature has investigated potential interactions between TB-500 and GHK-Cu in cultured cell systems or examined whether the peptides might modulate each other's cellular activity. The role of actin-sequestering activity in modulating extracellular-matrix signaling is not systematically studied. Furthermore, the relative timing and kinetics of TB-500 and GHK-Cu signaling responses, and whether the peptides might coordinate or antagonize cellular responses, remain uncharacterized in the published research.Review · PMID 27450730In vitro · PMID 32371360In vitro · PMID 28805225

The studies at a glance

Representative in-vitro characterization of TB-500 and GHK-Cu in cultured cell systems.

Frequently asked questions